Expired .NL domains

Expired .NL Domains

Description

.NL represents the official domain extension or the internet country code top-level domain (ccTLD) of the Netherlands. This ccTLD was introduced to the market in 1986 and was intended for entities with connection to Netherlands. It is ranked as one of the most popular ccTLDs in the internet with almost 6 million registered websites.

Registration Requirements

There is no special process needed to register a .NL domain name, no special action is needed on your end.

Intended Use

Entities connected with the Netherlands

.NL Registry Information

Registration Service

http://www.sidn.nl

Whois Server

whois.domain-registry.nl

Registration Date

1986-04-25

Whois Privacy

Yes

Backorder Services

  • CatchTiger.com
  • Hexonet.net
  • DomainOrder.com

Registration Price

$14.00 Annually

Registered Domains

5,156,667

.NL Stats Last 24hrs

Domains Count 330
Domains with backlinks 316
Majestic TF > 5 30
Moz DA > 5 13
Ahrefs DR > 5 9

.NL Stats Total

Domains Count 23268
Domains with backlinks 22205
Majestic TF > 5 2491
Moz DA > 5 1431
Ahrefs DR > 5 189

To See All 17726 .NL Domains

Example .NL Domains

Domain Name Majestic TF Majestic CF Moz DA Moz PA Ahrefs DR Ahrefs UR SZ Score Age Google Index
agngroep.nl 16 3 - - - - - - -
olympischnetwerkmiddennederland.nl 13 8 - - - - - - -
nonsyschins.nl 13 7 - - - - - - -
schriepet.nl 13 7 - - - - - - -
emmen-maniacs.nl 13 7 7 10 0 2 19 7 -
dakdrager-megastore.nl 13 6 - - - - - - -
trimsalonmuffin.nl 12 5 - - - - - - -
vertaalbureau-scandic.nl 11 11 10 17 2 23 10 12 0
deklokkenwinkel.nl 11 10 12 15 3 8 - - 1
carprigz.nl 10 8 - - - - - - -
bloemsma-automobielen.nl 9 7 - - - - - - -
fietsverlichtbrabant.nl 9 5 9 11 4 10 - 3 1
podiumheusden.nl 9 5 - - - - - - -
sexcamladies.nl 9 1 - - - - - - -
gayvideokijken.nl 9 6 7 11 0 2 - 10 1
houthandelvanmaris.nl 8 8 10 9 0 1 18 5 0
trollhattan.nl 7 4 - - - - - - -
mooimarseille.nl 7 6 - - - - - - -
downloadnsexfilm.nl 7 8 - - - - - - -
fenderrhodes.nl 7 6 13 13 1 5 8 16 -

.NL Top Registrars

Registrar name Registered domains Share, %
TransIP B.V. 427,168 9.90%
Metaregistrar BV 365,554 8.47%
Hostnet bv 279,941 6.49%
Realtime Register B.V. 207,433 4.81%
AXC BV 191,387 4.44%
Cronon AG 142,326 3.30%
One.com A/S 86,654 2.01%
The Registrar Company B.V. 70,259 1.63%
Mijn InternetOplossing B.V. 66,832 1.55%
GoDaddy.com, LLC 41,666 0.97%

.NL Domain Sales

Domain Price Date Venue
promocodes.nl $2,796.00 2019-05-27 Sedo
maya.nl $7,545.00 2019-05-16 Sedo
devise.nl $5,494.00 2019-04-23 Sedo
qad.nl $3,274.00 2019-04-11 Sedo
lootjes.nl $33,267.00 2019-04-10 Sedo
i-u.nl $2,571.00 2019-03-21 Sedo
lwr.nl $4,237.00 2019-03-18 Sedo
declareren.nl $6,756.00 2019-03-11 Sedo
kijkcijfer.nl $3,933.00 2019-03-08 Sedo
pizzapunten.nl $113.00 2019-02-21 Sedo